PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco030142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 175aa    MW: 19557.3 Da    PI: 7.4455
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco030142.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.3e-291059251
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 rien + rqvtfskRrng+lKKA+ELSvLCdaeva++ifs  gklye++s
  Aco030142.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALVIFSAAGKLYEFAS 59
                 8***********************************************86 PP

2K-box51.64e-18611233698
        K-box  36 RhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                   +l G ++es+sl+eL+ Le qLe+sl+kiRskK++ +l++i el++ke  l +en  Lr+k+
  Aco030142.1  61 EKLCGGGVESCSLEELHDLEAQLERSLSKIRSKKQRKILQEITELKEKESLLLKENALLREKV 123
                  5899*********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.076161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002655.19E-36360No hitNo description
SuperFamilySSF554552.62E-27361IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-30323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.18112129IPR002487Transcription factor, K-box
PRINTSPR004048.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-1759123IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MVRGRREMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALVIFSA AGKLYEFASS  60
EKLCGGGVES CSLEELHDLE AQLERSLSKI RSKKQRKILQ EITELKEKES LLLKENALLR  120
EKVRTQLLPS VPDQHLIPDD QPNGNMEVET DLIIGRPGTG EAQQQLANSS ETSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-17361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-17361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-17361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-17361260MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_R3e-17161161Myocyte-specific enhancer factor 2B
1tqe_S3e-17161161Myocyte-specific enhancer factor 2B
3kov_A3e-17361260Myocyte-specific enhancer factor 2A
3kov_B3e-17361260Myocyte-specific enhancer factor 2A
3kov_I3e-17361260Myocyte-specific enhancer factor 2A
3kov_J3e-17361260Myocyte-specific enhancer factor 2A
3mu6_A2e-17361260Myocyte-specific enhancer factor 2A
3mu6_B2e-17361260Myocyte-specific enhancer factor 2A
3mu6_C2e-17361260Myocyte-specific enhancer factor 2A
3mu6_D2e-17361260Myocyte-specific enhancer factor 2A
3p57_A3e-17361260Myocyte-specific enhancer factor 2A
3p57_B3e-17361260Myocyte-specific enhancer factor 2A
3p57_C3e-17361260Myocyte-specific enhancer factor 2A
3p57_D3e-17361260Myocyte-specific enhancer factor 2A
3p57_I3e-17361260Myocyte-specific enhancer factor 2A
3p57_J3e-17361260Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941167.11e-54PREDICTED: MADS-box protein SOC1-like isoform X1
RefseqXP_010941168.11e-54PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotQ9XJ602e-49MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLM0RQA63e-54M0RQA6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P07760_0017e-54(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.18e-41AGAMOUS-like 19